Panthera tigris altaica (Amur tiger): 102962543 Help Entry 102962543         CDS       T02988                                  Symbol IGF1, IGF-I Name (RefSeq) insulin like growth factor 1   KO K05459   insulin-like growth factor 1 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg01521   EGFR tyrosine kinase inhibitor resistance ptg01522   Endocrine resistance ptg04010   MAPK signaling pathway ptg04014   Ras signaling pathway ptg04015   Rap1 signaling pathway ptg04066   HIF-1 signaling pathway ptg04068   FoxO signaling pathway ptg04081   Hormone signaling ptg04114   Oocyte meiosis ptg04115   p53 signaling pathway ptg04150   mTOR signaling pathway ptg04151   PI3K-Akt signaling pathway ptg04152   AMPK signaling pathway ptg04211   Longevity regulating pathway ptg04213   Longevity regulating pathway - multiple species ptg04510   Focal adhesion ptg04550   Signaling pathways regulating pluripotency of stem cells ptg04730   Long-term depression ptg04750   Inflammatory mediator regulation of TRP channels ptg04913   Ovarian steroidogenesis ptg04914   Progesterone-mediated oocyte maturation ptg04935   Growth hormone synthesis, secretion and action ptg04960   Aldosterone-regulated sodium reabsorption ptg05200   Pathways in cancer ptg05202   Transcriptional misregulation in cancer ptg05205   Proteoglycans in cancer ptg05214   Glioma ptg05215   Prostate cancer ptg05218   Melanoma ptg05224   Breast cancer ptg05410   Hypertrophic cardiomyopathy ptg05414   Dilated cardiomyopathy Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102962543 (IGF1)    04014 Ras signaling pathway     102962543 (IGF1)    04015 Rap1 signaling pathway     102962543 (IGF1)    04066 HIF-1 signaling pathway     102962543 (IGF1)    04068 FoxO signaling pathway     102962543 (IGF1)    04151 PI3K-Akt signaling pathway     102962543 (IGF1)    04152 AMPK signaling pathway     102962543 (IGF1)    04150 mTOR signaling pathway     102962543 (IGF1)   09133 Signaling molecules and interaction    04081 Hormone signaling     102962543 (IGF1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102962543 (IGF1)    04115 p53 signaling pathway     102962543 (IGF1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102962543 (IGF1)    04550 Signaling pathways regulating pluripotency of stem cells     102962543 (IGF1)  09150 Organismal Systems   09152 Endocrine system    04913 Ovarian steroidogenesis     102962543 (IGF1)    04914 Progesterone-mediated oocyte maturation     102962543 (IGF1)    04935 Growth hormone synthesis, secretion and action     102962543 (IGF1)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     102962543 (IGF1)   09156 Nervous system    04730 Long-term depression     102962543 (IGF1)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     102962543 (IGF1)   09149 Aging    04211 Longevity regulating pathway     102962543 (IGF1)    04213 Longevity regulating pathway - multiple species     102962543 (IGF1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102962543 (IGF1)    05202 Transcriptional misregulation in cancer     102962543 (IGF1)    05205 Proteoglycans in cancer     102962543 (IGF1)   09162 Cancer: specific types    05214 Glioma     102962543 (IGF1)    05218 Melanoma     102962543 (IGF1)    05215 Prostate cancer     102962543 (IGF1)    05224 Breast cancer     102962543 (IGF1)   09166 Cardiovascular disease    05410 Hypertrophic cardiomyopathy     102962543 (IGF1)    05414 Dilated cardiomyopathy     102962543 (IGF1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102962543 (IGF1)    01522 Endocrine resistance     102962543 (IGF1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102962543 (IGF1) Cytokines and neuropeptides [BR:ptg04052]  Cytokines   Growth factors (RTK binding)    102962543 (IGF1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  102962543 NCBI-ProteinID:  XP_015394597 UniProt:  Q6GUL6 LinkDB All DBs Position Un AA seq 153 aa AA seqDB search MGKISSLPTQLFKCCFCDFLKVKMHIMSPSHLFYLGLCLLTFTSSATAGPETLCGAELVD ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS VRAQRHTDMPKAQKEVHLKNASRGSAGNKNYRM NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg aaggtaaagatgcacatcatgtccccctctcatctcttctatctgggcctgtgcttgctc accttcaccagctctgccacagctggaccagagacgctctgtggggctgagttggtggac gctcttcagttcgtgtgtggagacaggggtttttatttcaacaagcccacggggtatggc tccagcagtcggagggcacctcagacaggcatcgtggatgagtgctgcttccggagctgt gatctgaggcggctagagatgtactgtgcacccctcaagcctgccaagtctgcccgctca gtccgtgctcagcgccacactgacatgcccaaggctcagaaggaagtacatttgaagaac gcaagtagagggagtgcaggaaacaagaactacagaatgtag

DBGET integrated database retrieval system