Panthera tigris altaica (Amur tiger): 102963508 Help Entry 102963508         CDS       T02988                                  Symbol CLDN4 Name (RefSeq) claudin-4   KO K06087   claudin Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg03272   Virion - Hepatitis viruses ptg04382   Cornified envelope formation ptg04514   Cell adhesion molecules ptg04530   Tight junction ptg04670   Leukocyte transendothelial migration ptg05160   Hepatitis C Brite KEGG Orthology (KO) [BR:ptg00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     102963508 (CLDN4)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     102963508 (CLDN4)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     102963508 (CLDN4)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102963508 (CLDN4)   09158 Development and regeneration    04382 Cornified envelope formation     102963508 (CLDN4)  09160 Human Diseases   09172 Infectious disease: viral    05160 Hepatitis C     102963508 (CLDN4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ptg03037]     102963508 (CLDN4)    04147 Exosome [BR:ptg04147]     102963508 (CLDN4)    04515 Cell adhesion molecules [BR:ptg04515]     102963508 (CLDN4) Cilium and associated proteins [BR:ptg03037]  Other cilia and associated proteins   Stereociliary proteins    102963508 (CLDN4) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    102963508 (CLDN4)   Exosomal proteins of colorectal cancer cells    102963508 (CLDN4) Cell adhesion molecules [BR:ptg04515]  Immunoglobulin superfamily   L1 family    102963508 (CLDN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF7139 TMEM37 Motif Other DBs NCBI-GeneID:  102963508 NCBI-ProteinID:  XP_015393568 LinkDB All DBs Position Un AA seq 207 aa AA seqDB search MASMGLQVMGIALAVLGWLGAILSCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG QMQCKVYDSLLALPQDLQAARALMVVCIILAVLGVLLSVVGGKCTNCVEDESAKAKTMIV AGVVFILAGLLVMVPVSWTANNIIRDFYTPLVGSRPKREVGAXILGAASGLLLLGGALLC CSCPPRTDKPYSAKYSAARSAPASNYV NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcctccatgggactacaggtgatgggcatcgctctggccgtgctgggctggctgggc gccatactgagctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatc gtcacgtcgcagaccatctgggagggcctgtggatgaactgcgtggtgcagagcaccggc cagatgcagtgcaaggtatacgactcgctgctggcgctgccccaggacctgcaggcggcc cgtgccctcatggtcgtctgcatcatcctggccgtgctgggcgtgctgctgtccgtggtg ggcggcaagtgcaccaactgtgtggaggacgagagcgccaaggccaagaccatgatcgtg gcgggcgtggtgttcattctggccggcctgctggtaatggtgccggtgtcctggacggcc aacaacatcatccgggacttctacaccccgctggtgggctcccggccgaagcgggaggtg ggggccnncatactcggggccgcctcgggcctgctgctcctcgggggggccctgctgtgc tgcagttgcccaccgcgcaccgacaagccctactcggccaagtactctgccgcccgctcc gccccggccagcaactacgtgtaa

DBGET integrated database retrieval system