Panthera tigris altaica (Amur tiger): 102963799 Help Entry 102963799         CDS       T02988                                  Symbol GNG7 Name (RefSeq) G protein subunit gamma 7   KO K04543   guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-7 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04014   Ras signaling pathway ptg04062   Chemokine signaling pathway ptg04081   Hormone signaling ptg04082   Neuroactive ligand signaling ptg04151   PI3K-Akt signaling pathway ptg04371   Apelin signaling pathway ptg04713   Circadian entrainment ptg04723   Retrograde endocannabinoid signaling ptg04724   Glutamatergic synapse ptg04725   Cholinergic synapse ptg04726   Serotonergic synapse ptg04727   GABAergic synapse ptg04728   Dopaminergic synapse ptg04740   Olfactory transduction ptg04926   Relaxin signaling pathway ptg05032   Morphine addiction ptg05034   Alcoholism ptg05163   Human cytomegalovirus infection ptg05167   Kaposi sarcoma-associated herpesvirus infection ptg05170   Human immunodeficiency virus 1 infection ptg05200   Pathways in cancer Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102963799 (GNG7)    04371 Apelin signaling pathway     102963799 (GNG7)    04151 PI3K-Akt signaling pathway     102963799 (GNG7)   09133 Signaling molecules and interaction    04082 Neuroactive ligand signaling     102963799 (GNG7)    04081 Hormone signaling     102963799 (GNG7)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     102963799 (GNG7)   09152 Endocrine system    04926 Relaxin signaling pathway     102963799 (GNG7)   09156 Nervous system    04724 Glutamatergic synapse     102963799 (GNG7)    04727 GABAergic synapse     102963799 (GNG7)    04725 Cholinergic synapse     102963799 (GNG7)    04728 Dopaminergic synapse     102963799 (GNG7)    04726 Serotonergic synapse     102963799 (GNG7)    04723 Retrograde endocannabinoid signaling     102963799 (GNG7)   09157 Sensory system    04740 Olfactory transduction     102963799 (GNG7)   09159 Environmental adaptation    04713 Circadian entrainment     102963799 (GNG7)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102963799 (GNG7)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102963799 (GNG7)    05163 Human cytomegalovirus infection     102963799 (GNG7)    05167 Kaposi sarcoma-associated herpesvirus infection     102963799 (GNG7)   09165 Substance dependence    05032 Morphine addiction     102963799 (GNG7)    05034 Alcoholism     102963799 (GNG7)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102963799 (GNG7)    04031 GTP-binding proteins [BR:ptg04031]     102963799 (GNG7) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102963799 (GNG7)   Exosomal proteins of other body fluids (saliva and urine)    102963799 (GNG7) GTP-binding proteins [BR:ptg04031]  Heterotrimeric G-proteins   Gamma Subunits    Gamma [OT]     102963799 (GNG7) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  G-gamma FtsX_ECD CP12 Motif Other DBs NCBI-GeneID:  102963799 NCBI-ProteinID:  XP_007075229 UniProt:  A0A8C9K654 LinkDB All DBs Position Un AA seq 68 aa AA seqDB search MSATNNIAQARKLVEQLRIEAGIERIKVSKASSELMSYCEQHARNDPLLVGVPASENPFK DKKPCIIL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgtcagccactaacaacatagcccaggcccggaagctggtggaacagctccgcatcgaa gccgggatcgagcgcatcaaggtgtccaaagcctcatcggaactcatgagctactgcgag cagcacgcccggaatgaccccctgctggtcggagtccccgcgtccgagaacccctttaag gacaagaagccctgtattattctgtag

DBGET integrated database retrieval system