Panthera tigris altaica (Amur tiger): 102964234 Help Entry 102964234         CDS       T02988                                  Symbol CALML3 Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04014   Ras signaling pathway ptg04015   Rap1 signaling pathway ptg04020   Calcium signaling pathway ptg04022   cGMP-PKG signaling pathway ptg04024   cAMP signaling pathway ptg04070   Phosphatidylinositol signaling system ptg04114   Oocyte meiosis ptg04218   Cellular senescence ptg04261   Adrenergic signaling in cardiomyocytes ptg04270   Vascular smooth muscle contraction ptg04371   Apelin signaling pathway ptg04625   C-type lectin receptor signaling pathway ptg04713   Circadian entrainment ptg04720   Long-term potentiation ptg04722   Neurotrophin signaling pathway ptg04728   Dopaminergic synapse ptg04740   Olfactory transduction ptg04744   Phototransduction ptg04750   Inflammatory mediator regulation of TRP channels ptg04910   Insulin signaling pathway ptg04912   GnRH signaling pathway ptg04915   Estrogen signaling pathway ptg04916   Melanogenesis ptg04921   Oxytocin signaling pathway ptg04922   Glucagon signaling pathway ptg04924   Renin secretion ptg04925   Aldosterone synthesis and secretion ptg04970   Salivary secretion ptg04971   Gastric acid secretion ptg05010   Alzheimer disease ptg05012   Parkinson disease ptg05022   Pathways of neurodegeneration - multiple diseases ptg05031   Amphetamine addiction ptg05034   Alcoholism ptg05133   Pertussis ptg05152   Tuberculosis ptg05163   Human cytomegalovirus infection ptg05167   Kaposi sarcoma-associated herpesvirus infection ptg05170   Human immunodeficiency virus 1 infection ptg05200   Pathways in cancer ptg05214   Glioma ptg05417   Lipid and atherosclerosis ptg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102964234 (CALML3)    04015 Rap1 signaling pathway     102964234 (CALML3)    04371 Apelin signaling pathway     102964234 (CALML3)    04020 Calcium signaling pathway     102964234 (CALML3)    04070 Phosphatidylinositol signaling system     102964234 (CALML3)    04024 cAMP signaling pathway     102964234 (CALML3)    04022 cGMP-PKG signaling pathway     102964234 (CALML3)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102964234 (CALML3)    04218 Cellular senescence     102964234 (CALML3)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102964234 (CALML3)   09152 Endocrine system    04910 Insulin signaling pathway     102964234 (CALML3)    04922 Glucagon signaling pathway     102964234 (CALML3)    04912 GnRH signaling pathway     102964234 (CALML3)    04915 Estrogen signaling pathway     102964234 (CALML3)    04921 Oxytocin signaling pathway     102964234 (CALML3)    04916 Melanogenesis     102964234 (CALML3)    04924 Renin secretion     102964234 (CALML3)    04925 Aldosterone synthesis and secretion     102964234 (CALML3)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102964234 (CALML3)    04270 Vascular smooth muscle contraction     102964234 (CALML3)   09154 Digestive system    04970 Salivary secretion     102964234 (CALML3)    04971 Gastric acid secretion     102964234 (CALML3)   09156 Nervous system    04728 Dopaminergic synapse     102964234 (CALML3)    04720 Long-term potentiation     102964234 (CALML3)    04722 Neurotrophin signaling pathway     102964234 (CALML3)   09157 Sensory system    04744 Phototransduction     102964234 (CALML3)    04740 Olfactory transduction     102964234 (CALML3)    04750 Inflammatory mediator regulation of TRP channels     102964234 (CALML3)   09159 Environmental adaptation    04713 Circadian entrainment     102964234 (CALML3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102964234 (CALML3)   09162 Cancer: specific types    05214 Glioma     102964234 (CALML3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102964234 (CALML3)    05163 Human cytomegalovirus infection     102964234 (CALML3)    05167 Kaposi sarcoma-associated herpesvirus infection     102964234 (CALML3)   09171 Infectious disease: bacterial    05133 Pertussis     102964234 (CALML3)    05152 Tuberculosis     102964234 (CALML3)   09164 Neurodegenerative disease    05010 Alzheimer disease     102964234 (CALML3)    05012 Parkinson disease     102964234 (CALML3)    05022 Pathways of neurodegeneration - multiple diseases     102964234 (CALML3)   09165 Substance dependence    05031 Amphetamine addiction     102964234 (CALML3)    05034 Alcoholism     102964234 (CALML3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102964234 (CALML3)    05418 Fluid shear stress and atherosclerosis     102964234 (CALML3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ptg01009]     102964234 (CALML3)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptg04131]     102964234 (CALML3)    03036 Chromosome and associated proteins [BR:ptg03036]     102964234 (CALML3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102964234 (CALML3) Protein phosphatases and associated proteins [BR:ptg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102964234 (CALML3) Membrane trafficking [BR:ptg04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102964234 (CALML3) Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102964234 (CALML3) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102964234 (CALML3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 SPARC_Ca_bdg UPF0154 EH Dockerin_1 EF_EFCAB10_C Temptin_C EFhand_Ca_insen EF-hand_11 Caleosin DUF5580_M SurA_N_3 SurA_N_2 Motif Other DBs NCBI-GeneID:  102964234 NCBI-ProteinID:  XP_007081232 UniProt:  A0A8C9M2R6 LinkDB All DBs Position Un AA seq 149 aa AA seqDB search MADQLTEEQVAEFREAFCLFDKDGDGAITTQELGTVMRSLGQNPTEAELRDMVGEIDRDG NGSVDFPEFLGMMARQLRGRDSEEQIREAFRVFDKDGNGLVSAAELRHVMTRLGEKLSDD EVDEMIRAADVDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgacggaggaacaggtggccgagttcagggaggccttctgtctgttc gacaaggacggggacggcgccatcaccacccaggagctgggcaccgtcatgcggtccctg ggccagaaccccacggaggccgagctccgggacatggtgggcgagatcgaccgtgacggc aatggctccgtggacttccctgagttcctgggcatgatggcccggcagctgaggggcagg gacagcgaggagcagatccgggaggccttccgcgtgttcgacaaggacggcaacggcctg gtgagcgcggccgagctgcggcacgtgatgaccaggctcggggagaagctgagcgacgac gaggtggacgagatgatccgggcggccgacgtggacggggacggccaggtcaactacgag gagttcgtgcacatgctggtctccaagtga

DBGET integrated database retrieval system