Panthera tigris altaica (Amur tiger): 102966154 Help Entry 102966154         CDS       T02988                                  Symbol PFN4 Name (RefSeq) profilin family member 4   KO K05759   profilin Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04015   Rap1 signaling pathway ptg04810   Regulation of actin cytoskeleton ptg05014   Amyotrophic lateral sclerosis ptg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     102966154 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102966154 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102966154 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     102966154 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptg04131]     102966154 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ptg04812]     102966154 (PFN4)    04147 Exosome [BR:ptg04147]     102966154 (PFN4) Membrane trafficking [BR:ptg04131]  Others   Actin-binding proteins    Others     102966154 (PFN4) Cytoskeleton proteins [BR:ptg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      102966154 (PFN4) Exosome [BR:ptg04147]  Exosomal proteins   Proteins found in most exosomes    102966154 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  102966154 NCBI-ProteinID:  XP_007080791 UniProt:  A0A8C9MB62 LinkDB All DBs Position Un AA seq 129 aa AA seqDB search MSHLQNLLLDTLLGTKHVDSAALIKLQERSLSVASPGFSVMPSDVRTLVNGFAKNPLQTR REGLYFKEKDYKCVRADDYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSVCVEATEKL GEYLRRKGN NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagaacttactgttagataccctcctgggaacaaagcatgtggacagt gcagccctcatcaaactccaggagcgaagcttgagtgtagcatcaccaggatttagtgta atgcccagtgatgtccgaactcttgtgaatggattcgccaagaaccctttgcaaaccaga agagaaggactgtatttcaaggaaaaggactacaaatgtgtccgggcagatgactattct ctttatgctaagaatgaaaacactggtgtggttgttgtgaagacccatctgtatcttctg gtggcaacttacactgaaggcatgtatcctagtgtttgtgtggaagccacagagaaactg ggagaatatctaagaagaaaaggaaattaa

DBGET integrated database retrieval system