Panthera tigris altaica (Amur tiger): 102967302 Help Entry 102967302         CDS       T02988                                  Name (RefSeq) histone H2A.Z   KO K11251   histone H2A Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg03082   ATP-dependent chromatin remodeling ptg04217   Necroptosis ptg04613   Neutrophil extracellular trap formation ptg05034   Alcoholism ptg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptg00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     102967302  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     102967302  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102967302  09160 Human Diseases   09163 Immune disease    05322 Systemic lupus erythematosus     102967302   09165 Substance dependence    05034 Alcoholism     102967302  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptg03036]     102967302   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102967302 Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102967302 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102967302 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone Histone_H2A_C CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  102967302 NCBI-ProteinID:  XP_007081020 UniProt:  A0A8C9JYX5 LinkDB All DBs Position Un AA seq 128 aa AA seqDB search MAGGKAGEDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG KKGQQKTV NT seq 387 nt NT seq  +upstreamnt  +downstreamnt atggctggcggtaaggctggggaggactccggaaaggccaagacaaaggcggtttcccgc tcgcagagagccggcttgcagttcccggtgggccgtattcatcgacacctgaaatctagg acgaccagtcatggacgtgtgggcgcgactgccgctgtgtacagcgcagccatcctggag tacctcaccgcagaggtacttgaattggcaggaaatgcatcaaaagacttgaaggtaaag cgtattactcctcgtcacttgcaacttgctattcgtggagatgaggaattggattctctc atcaaggctacaattgctggtggtggtgtcattccacacatccacaaatctctgattggg aagaaaggacaacagaagactgtttaa

DBGET integrated database retrieval system