KEGG   Panthera tigris altaica (Amur tiger): 102967405
Entry
102967405         CDS       T02988                                 
Symbol
TNFRSF8
Name
(RefSeq) TNF receptor superfamily member 8
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
ptg  Panthera tigris altaica (Amur tiger)
Pathway
ptg04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ptg00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102967405 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ptg04050]
    102967405 (TNFRSF8)
   04090 CD molecules [BR:ptg04090]
    102967405 (TNFRSF8)
Cytokine receptors [BR:ptg04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102967405 (TNFRSF8)
CD molecules [BR:ptg04090]
 Proteins
  102967405 (TNFRSF8)
SSDB
Motif
Pfam: CoV_E
Other DBs
NCBI-GeneID: 102967405
NCBI-ProteinID: XP_015393635
LinkDB
Position
Un
AA seq 701 aa
MYYKAMNLNEWPPLATMIEFRGTSMLETLATITTKLPAPCPSSTCHDLAALDLNRPLHQK
SESKEKGYFPGAFVKLSEMGLIGLPCPQGSPDCRKQCEPDYYLNRDGRCTACVSCARGAV
FFACDHKCFQEILPMSTFIVNFLLCDTSAQARPLVTSVSSSARTMLLGGGTAITPEDDSK
MTGAPGSPSSVRKPSPDPGLPPQPPCPQGSPDCRKQCEPDYYLDRDGRCTACVSCARGAV
SFACDHKCFQEILPMSTFIVNFLLCDTSAQAGPPVTSSVSSSARTTLLGGDTAITPEDDS
KMTGAPGSPSSVRKPSPDPGLTPQPPCPQGSPDCRKQCEPDYYLDRDGRCTACVSCARDD
LVEKTPCTWNSSRVCECRPGMFCVTPVTNSCAHCVTRPVCPPGMATKPQGTAERDATHEP
PPPLEAHPECSTNPEDSKAPTSATASPVSAADPQGSKEHGGGNTHTWGDTFTSASSPISF
SSTGRPILVSGPVLFWMVMILVVVLVSISFLLCHWRACRKWIRQKLHLCYPAQTFRPTLE
PVDSRPRRNLTQLRSCISVAEPGTEELGLMGPPAMETCPNGEVCLESMRLLDASPAGSPP
SPRDLPEPRVTSEHTNNRIEKIYIMKADTVIVGTVRTEVPEGRGLAGPTGPELEEDLEGD
HAYPHFPEQETEPPLGSCGDVMFSVEEEGKEAPLPMTVSEK
NT seq 2106 nt   +upstreamnt  +downstreamnt
atgtactacaaagcaatgaacctgaatgaatggccaccattggcaacaatgatcgagttc
cgagggacgtctatgctggagaccctggccaccatcacgacaaaactgccggcaccctgc
ccatccagcacctgccacgacctggcagcgctggacttaaaccgccctttgcaccagaag
tctgaaagtaaagagaagggctatttcccaggagcttttgtgaaactctcagagatgggg
ctcattgggctgccgtgcccccaggggtcacctgactgcaggaagcagtgtgagcccgac
tactacctgaacagggacggccgctgcacggcctgtgtgagctgtgctcggggagctgtg
ttctttgcctgcgaccacaagtgcttccaggagattcttccaatgagcactttcattgtt
aatttcttactatgcgacaccagcgcccaggccaggcccctggtgacctcagtgagctcc
agtgccaggaccatgctccttggagggggcactgccatcacccccgaagatgactccaaa
atgacgggggcccccggctctccctcctctgtgaggaagcccagtccagatccagggctg
cccccgcagccgccgtgtccccaggggtcacctgactgtaggaagcagtgtgagcccgac
tactacctggacagggacggccgctgcacggcctgtgtgagctgtgctcgaggagctgtg
tcctttgcctgcgaccacaagtgcttccaggagattcttccaatgagcactttcattgtt
aatttcttactatgcgacaccagcgcccaggccgggcccccggtgacctcctcagtgagc
tccagtgccaggaccacgctccttggaggggacactgccatcacccccgaagatgattcc
aaaatgacgggggcccccggctctccctcctctgtgaggaagcccagtccagatccaggg
ctgaccccgcagcccccgtgtccccaggggtcacctgactgtaggaagcagtgtgagccc
gactactacctggacagggacggccgctgcacggcctgtgtgagctgtgctcgagatgac
ctggtggagaagacaccctgtacctggaactcctctcgtgtctgcgaatgtcgacctggc
atgttctgtgtcacaccagtcaccaactcctgtgcccactgtgtcacccgccccgtctgc
ccaccaggcatggccactaaaccccagggtacagctgagagggatgccacccatgagccg
ccgcctcccctagaagcccaccccgagtgcagcaccaacccagaggacagcaaggcgccc
accagcgccacggcctctccggtctccgcagcagacccccaaggcagtaaggagcatgga
gggggcaacacccacacctggggagacaccttcacatcagcgagctcccctatctctttc
tcctccacgggaaggcccattctggtttccggacctgtgctcttctggatggtcatgatc
ctggtggtggtcttggtctccatctccttcctcctgtgccactggagggcctgcaggaag
tggattcggcagaagctccacctgtgctaccctgcccagaccttccggcccacgctggag
cctgtggattccaggcccaggaggaacctgacccagttgaggagttgcatatcggtggcc
gagccgggcacagaggagctgggattaatgggccccccggccatggagacctgccccaac
ggggaagtctgcctggagagcatgcggctgctggatgccagcccggccgggagccccccg
tcccccagggaccttcccgagccccgggtgacctcagagcataccaacaacaggatcgag
aaaatctacatcatgaaggctgacacagtgattgtggggaccgtgaggaccgaggtgcct
gagggccggggcctggcggggccgacggggcctgaattggaggaggatctggaaggggac
cacgcgtacccccacttcccggagcaggagacagagccgcctctgggcagctgcggggac
gtcatgttctcagtagaagaggaaggaaaggaggcccccttgcccatgactgtctctgag
aaatga

DBGET integrated database retrieval system