Panthera tigris altaica (Amur tiger): 102968905 Help Entry 102968905         CDS       T02988                                  Name (RefSeq) histone H2B type 1-A-like   KO K11252   histone H2B Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04613   Neutrophil extracellular trap formation ptg05034   Alcoholism ptg05203   Viral carcinogenesis ptg05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:ptg00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     102968905  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     102968905   09163 Immune disease    05322 Systemic lupus erythematosus     102968905   09165 Substance dependence    05034 Alcoholism     102968905  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptg03036]     102968905   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102968905 Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Nucleosome assembly factors    Histones     102968905 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    102968905 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa CvfB_WH Motif Other DBs NCBI-GeneID:  102968905 NCBI-ProteinID:  XP_007074491 UniProt:  A0A8C9IZK1 LinkDB All DBs Position Un AA seq 126 aa AA seqDB search MAELISKGSTISKKGFKKAVTKTQKKERKRRRCRRESYSVYVYKVLKQVHPDTGISSKAM STMNSFVGDIFERIAGEASRLAHYNKRSTITSREIQTVVRLLLPGELAKHAVSEGTKAVT KYTSAK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggcggagctgatttccaagggctcgaccatttccaagaaaggcttcaagaaagctgta accaaaacccagaagaaggaaagaaagcgcaggcgatgccgtagggagagctattccgtt tatgtctacaaggtgctgaagcaggtgcaccccgacaccggcatctcgtccaaggcgatg agcaccatgaactccttcgtcggtgacatcttcgagcgcatcgcgggcgaggcgtcgcgc ctggcgcactacaacaagcgctcgaccatcacgtcccgggagatccagacggtcgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtccgagggcaccaaggccgtcacc aagtacaccagcgcgaagtaa

DBGET integrated database retrieval system