Panthera tigris altaica (Amur tiger): 102969693 Help Entry 102969693         CDS       T02988                                  Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04621   NOD-like receptor signaling pathway ptg05012   Parkinson disease ptg05132   Salmonella infection ptg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     102969693  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102969693   09164 Neurodegenerative disease    05012 Parkinson disease     102969693   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     102969693  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:ptg03110]     102969693 Chaperones and folding catalysts [BR:ptg03110]  Protein folding catalysts   Protein disulfide isomerase    102969693 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 Thioredoxin_9 Thioredoxin_2 DIM1 Thioredoxin_7 Redoxin DUF19 AhpC-TSA OST3_OST6 Motif Other DBs NCBI-GeneID:  102969693 NCBI-ProteinID:  XP_015393030 LinkDB All DBs Position Un AA seq 118 aa AA seqDB search MVLTAACQTPTAKMVKQIESKYAFQEALNSAGEKLVVVDFSAMWCGPCKTIKPFFHSFSD KYSNMAFLEADVDDCWDVASEREVKCMPTFQFFKKGQKVGELSGASKEKLEATINELI NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggtccttacagccgcttgtcagaccccaactgccaaaatggtgaagcagattgagagc aagtatgcttttcaggaagccttgaacagtgcaggggaaaaacttgtagtagttgacttt tcagccatgtggtgtgggccttgcaaaacgattaagcctttctttcattccttctctgac aagtattccaacatggcgttccttgaagcagatgtggatgactgttgggatgttgcttca gagcgtgaagtcaaatgcatgccaaccttccagttttttaaaaaaggacaaaaggtgggt gaactttctggggctagtaaggaaaaacttgaagctaccattaatgaattaatctaa

DBGET integrated database retrieval system