Panthera tigris altaica (Amur tiger): 102969892 Help Entry 102969892         CDS       T02988                                  Symbol MYL10 Name (RefSeq) myosin light chain 10   KO K12756   myosin regulatory light chain 10 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04510   Focal adhesion ptg04520   Adherens junction ptg04670   Leukocyte transendothelial migration ptg04810   Regulation of actin cytoskeleton ptg04814   Motor proteins ptg05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ptg00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     102969892 (MYL10)    04520 Adherens junction     102969892 (MYL10)   09142 Cell motility    04814 Motor proteins     102969892 (MYL10)    04810 Regulation of actin cytoskeleton     102969892 (MYL10)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     102969892 (MYL10)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102969892 (MYL10)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:ptg04812]     102969892 (MYL10) Cytoskeleton proteins [BR:ptg04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      102969892 (MYL10) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SAPC2_N EF_EFCAB10_C EF-hand_FSTL1 AIF-1 Motif Other DBs NCBI-GeneID:  102969892 NCBI-ProteinID:  XP_007073963 LinkDB All DBs Position Un AA seq 167 aa AA seqDB search MAPRRARKRAEGGASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFAALGRI NVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADFI KEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRSLCYIITHGEEKD NT seq 504 nt NT seq  +upstreamnt  +downstreamnt atggcaccgagaagggcccgcaagagagcggagggcggagccagctccaatgtcttctcc atgtttgatcagtcccagatccaggagtttaaagaggccttcaccatcatggaccagaac cgggatggcttcatcgacaaggaggacctgagagacacctttgctgccttgggccgcatc aacgtgaagaacgaggagctggaggccatggtgaaggaggcccccgggcccatcaacttc accgtcttcctgaccatgttcggggagaagctgaagggtacggacccagaggagaccatt ctccacgccttcaaggtgtttgacaccgaagggaaaggtttcgtcaaggctgatttcatc aaagagaaactcatgacccaggcggaccggttcagtgaggaggaggtcaagcagatgttc gcggctttccctccagacgtgtgtggcaacctggactacaggagcctgtgctacatcatc acccacggcgaagagaaggactag

DBGET integrated database retrieval system