Panthera tigris altaica (Amur tiger): 102971086 Help Entry 102971086         CDS       T02988                                  Symbol GHRH Name (RefSeq) growth hormone releasing hormone   KO K05260   growth hormone-releasing hormone Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04080   Neuroactive ligand-receptor interaction ptg04935   Growth hormone synthesis, secretion and action Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102971086 (GHRH)  09150 Organismal Systems   09152 Endocrine system    04935 Growth hormone synthesis, secretion and action     102971086 (GHRH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102971086 (GHRH) Cytokines and neuropeptides [BR:ptg04052]  Neuropeptides   Neuropeptides (GPCR binding)    102971086 (GHRH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Hormone_2 Motif Other DBs NCBI-GeneID:  102971086 NCBI-ProteinID:  XP_015391004 UniProt:  A0A8C9M2U1 LinkDB All DBs Position Un AA seq 106 aa AA seqDB search MLLWVFFLVILTLDSGSPCSPPSLPLRMPRYADAIFTNSYRKVLGQLSARKLLQDIMSRQ QGERNQEQGAKVRLGRQVDSVWAGQKQMALESILVALLQKHRNRQG NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgctgctctgggtgttcttcctggtgatcctcaccctcgacagtggctccccctgctcc ccgccatccctgcccctcagaatgcctcggtatgcagatgccatcttcaccaacagctac cggaaggtgctgggtcagctgtctgcccgcaagctactgcaggacatcatgagcaggcag cagggagagagaaaccaggagcaaggagcaaaggtacggcttggccgtcaggtggacagc gtgtgggcaggtcaaaagcagatggcgttggagagcatcctggtggccctgctgcagaag cacaggaatcgccaaggatga

DBGET integrated database retrieval system