Panthera tigris altaica (Amur tiger): 102971520 Help Entry 102971520         CDS       T02988                                  Name (RefSeq) calmodulin-alpha-like   KO K02183   calmodulin Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04014   Ras signaling pathway ptg04015   Rap1 signaling pathway ptg04020   Calcium signaling pathway ptg04022   cGMP-PKG signaling pathway ptg04024   cAMP signaling pathway ptg04070   Phosphatidylinositol signaling system ptg04114   Oocyte meiosis ptg04218   Cellular senescence ptg04261   Adrenergic signaling in cardiomyocytes ptg04270   Vascular smooth muscle contraction ptg04371   Apelin signaling pathway ptg04625   C-type lectin receptor signaling pathway ptg04713   Circadian entrainment ptg04720   Long-term potentiation ptg04722   Neurotrophin signaling pathway ptg04728   Dopaminergic synapse ptg04740   Olfactory transduction ptg04744   Phototransduction ptg04750   Inflammatory mediator regulation of TRP channels ptg04910   Insulin signaling pathway ptg04912   GnRH signaling pathway ptg04915   Estrogen signaling pathway ptg04916   Melanogenesis ptg04921   Oxytocin signaling pathway ptg04922   Glucagon signaling pathway ptg04924   Renin secretion ptg04925   Aldosterone synthesis and secretion ptg04970   Salivary secretion ptg04971   Gastric acid secretion ptg05010   Alzheimer disease ptg05012   Parkinson disease ptg05022   Pathways of neurodegeneration - multiple diseases ptg05031   Amphetamine addiction ptg05034   Alcoholism ptg05133   Pertussis ptg05152   Tuberculosis ptg05163   Human cytomegalovirus infection ptg05167   Kaposi sarcoma-associated herpesvirus infection ptg05170   Human immunodeficiency virus 1 infection ptg05200   Pathways in cancer ptg05214   Glioma ptg05417   Lipid and atherosclerosis ptg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     102971520    04015 Rap1 signaling pathway     102971520    04371 Apelin signaling pathway     102971520    04020 Calcium signaling pathway     102971520    04070 Phosphatidylinositol signaling system     102971520    04024 cAMP signaling pathway     102971520    04022 cGMP-PKG signaling pathway     102971520  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     102971520    04218 Cellular senescence     102971520  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102971520   09152 Endocrine system    04910 Insulin signaling pathway     102971520    04922 Glucagon signaling pathway     102971520    04912 GnRH signaling pathway     102971520    04915 Estrogen signaling pathway     102971520    04921 Oxytocin signaling pathway     102971520    04916 Melanogenesis     102971520    04924 Renin secretion     102971520    04925 Aldosterone synthesis and secretion     102971520   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     102971520    04270 Vascular smooth muscle contraction     102971520   09154 Digestive system    04970 Salivary secretion     102971520    04971 Gastric acid secretion     102971520   09156 Nervous system    04728 Dopaminergic synapse     102971520    04720 Long-term potentiation     102971520    04722 Neurotrophin signaling pathway     102971520   09157 Sensory system    04744 Phototransduction     102971520    04740 Olfactory transduction     102971520    04750 Inflammatory mediator regulation of TRP channels     102971520   09159 Environmental adaptation    04713 Circadian entrainment     102971520  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102971520   09162 Cancer: specific types    05214 Glioma     102971520   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     102971520    05163 Human cytomegalovirus infection     102971520    05167 Kaposi sarcoma-associated herpesvirus infection     102971520   09171 Infectious disease: bacterial    05133 Pertussis     102971520    05152 Tuberculosis     102971520   09164 Neurodegenerative disease    05010 Alzheimer disease     102971520    05012 Parkinson disease     102971520    05022 Pathways of neurodegeneration - multiple diseases     102971520   09165 Substance dependence    05031 Amphetamine addiction     102971520    05034 Alcoholism     102971520   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102971520    05418 Fluid shear stress and atherosclerosis     102971520  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ptg01009]     102971520   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptg04131]     102971520    03036 Chromosome and associated proteins [BR:ptg03036]     102971520   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102971520 Protein phosphatases and associated proteins [BR:ptg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      102971520 Membrane trafficking [BR:ptg04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     102971520 Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      102971520 Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    102971520 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF_EFCAB10_C EF-hand_9 EH AIF-1 FCaBP_EF-hand EFhand_Ca_insen DUF2750 COMMD1_N Motif Other DBs NCBI-GeneID:  102971520 NCBI-ProteinID:  XP_015395583 UniProt:  A0A8C9J7K6 LinkDB All DBs Position Un AA seq 130 aa AA seqDB search MADEVTEEQIAEFKGAFSLLDKDGNGTITTKERRIVMRSWSQNPAGAKLQEMINDEVDAD ANGTIDFAEFLTAMARKMKDTSSEEEICEVFRVFYKDGNGYISVAELCRVMTNLGETLTD EEINDQRSRY NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atggctgacgaggtgaccgaagaacagattgccgagttcaagggagccttctccctactt gacaaagatggcaatggcaccatcacaacaaaggaacgtagaattgtcatgaggtcatgg agtcagaacccagcaggagccaaattgcaggagatgatcaatgatgaggtggatgctgat gctaatggcaccattgacttcgcagaatttttgactgcaatggctagaaaaatgaaagat acaagcagtgaagaagaaatttgcgaagtgttccgagttttttacaaggatgggaatggt tatatcagtgtggcagaactatgtcgtgtcatgacaaacttaggagaaacactaacagat gaagaaataaatgatcagagaagtagatattga

DBGET integrated database retrieval system