Panthera tigris altaica (Amur tiger): 102971941 Help Entry 102971941         CDS       T02988                                  Symbol FGF22 Name (RefSeq) fibroblast growth factor 22   KO K04358   fibroblast growth factor Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04010   MAPK signaling pathway ptg04014   Ras signaling pathway ptg04015   Rap1 signaling pathway ptg04020   Calcium signaling pathway ptg04151   PI3K-Akt signaling pathway ptg04810   Regulation of actin cytoskeleton ptg05200   Pathways in cancer ptg05207   Chemical carcinogenesis - receptor activation ptg05218   Melanoma ptg05224   Breast cancer ptg05226   Gastric cancer Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102971941 (FGF22)    04014 Ras signaling pathway     102971941 (FGF22)    04015 Rap1 signaling pathway     102971941 (FGF22)    04020 Calcium signaling pathway     102971941 (FGF22)    04151 PI3K-Akt signaling pathway     102971941 (FGF22)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     102971941 (FGF22)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102971941 (FGF22)    05207 Chemical carcinogenesis - receptor activation     102971941 (FGF22)   09162 Cancer: specific types    05226 Gastric cancer     102971941 (FGF22)    05218 Melanoma     102971941 (FGF22)    05224 Breast cancer     102971941 (FGF22)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ptg04052]     102971941 (FGF22)    00536 Glycosaminoglycan binding proteins [BR:ptg00536]     102971941 (FGF22) Cytokines and neuropeptides [BR:ptg04052]  Cytokines   Growth factors (RTK binding)    102971941 (FGF22) Glycosaminoglycan binding proteins [BR:ptg00536]  Heparan sulfate / Heparin   Growth factors/receptors    102971941 (FGF22) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Fascin Motif Other DBs NCBI-GeneID:  102971941 NCBI-ProteinID:  XP_007075791 LinkDB All DBs Position Un AA seq 141 aa AA seqDB search MSSYPHLEGDVRWRRLFSSTHFFLRVDPSGRVQGTRWRHGADSIIEIRSIRVGVVALKAV HTGFYVAMNRGGHLYGSRVYTTHCRFQERIEENGYNTYASLRWRHRGRPMFLALDGQGSP RRGGRTQRHHLSTHFLPVLVS NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgagcagctacccacacctggagggcgacgtgcgctggaggcgcctcttctcctccacc cacttcttcctgcgagtggaccccagcggccgcgtgcagggcacccgctggcgtcacgga gctgacagcatcattgagatccgctccatccgtgtgggcgtcgtggccctcaaggctgtg cacaccggcttctacgtggccatgaaccgagggggccatctctacgggtcgcgggtctac accacccactgcaggttccaggagcgcatcgaggagaacggctataacacctacgcctcg ctccgctggcgtcaccgcggtcggcccatgttcctggcgctggatgggcaggggtccccg aggcgcggtggccggacacagcggcaccacctgtccacccacttcctgcccgtcctggtc tcctga

DBGET integrated database retrieval system