Panthera tigris altaica (Amur tiger): 102973021 Help Entry 102973021         CDS       T02988                                  Symbol CDC42 Name (RefSeq) cell division cycle 42   KO K04393   cell division control protein 42 Organism ptg  Panthera tigris altaica (Amur tiger) Pathway ptg04010   MAPK signaling pathway ptg04014   Ras signaling pathway ptg04015   Rap1 signaling pathway ptg04062   Chemokine signaling pathway ptg04144   Endocytosis ptg04360   Axon guidance ptg04370   VEGF signaling pathway ptg04510   Focal adhesion ptg04517   IgSF CAM signaling ptg04518   Integrin signaling ptg04520   Adherens junction ptg04530   Tight junction ptg04660   T cell receptor signaling pathway ptg04666   Fc gamma R-mediated phagocytosis ptg04670   Leukocyte transendothelial migration ptg04722   Neurotrophin signaling pathway ptg04810   Regulation of actin cytoskeleton ptg04912   GnRH signaling pathway ptg04932   Non-alcoholic fatty liver disease ptg04933   AGE-RAGE signaling pathway in diabetic complications ptg05100   Bacterial invasion of epithelial cells ptg05132   Salmonella infection ptg05135   Yersinia infection ptg05165   Human papillomavirus infection ptg05200   Pathways in cancer ptg05203   Viral carcinogenesis ptg05205   Proteoglycans in cancer ptg05211   Renal cell carcinoma ptg05212   Pancreatic cancer ptg05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ptg00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102973021 (CDC42)    04014 Ras signaling pathway     102973021 (CDC42)    04015 Rap1 signaling pathway     102973021 (CDC42)    04370 VEGF signaling pathway     102973021 (CDC42)   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     102973021 (CDC42)    04518 Integrin signaling     102973021 (CDC42)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102973021 (CDC42)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102973021 (CDC42)    04520 Adherens junction     102973021 (CDC42)    04530 Tight junction     102973021 (CDC42)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102973021 (CDC42)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     102973021 (CDC42)    04666 Fc gamma R-mediated phagocytosis     102973021 (CDC42)    04670 Leukocyte transendothelial migration     102973021 (CDC42)    04062 Chemokine signaling pathway     102973021 (CDC42)   09152 Endocrine system    04912 GnRH signaling pathway     102973021 (CDC42)   09156 Nervous system    04722 Neurotrophin signaling pathway     102973021 (CDC42)   09158 Development and regeneration    04360 Axon guidance     102973021 (CDC42)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102973021 (CDC42)    05205 Proteoglycans in cancer     102973021 (CDC42)    05203 Viral carcinogenesis     102973021 (CDC42)   09162 Cancer: specific types    05212 Pancreatic cancer     102973021 (CDC42)    05211 Renal cell carcinoma     102973021 (CDC42)   09172 Infectious disease: viral    05165 Human papillomavirus infection     102973021 (CDC42)   09171 Infectious disease: bacterial    05132 Salmonella infection     102973021 (CDC42)    05135 Yersinia infection     102973021 (CDC42)    05100 Bacterial invasion of epithelial cells     102973021 (CDC42)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102973021 (CDC42)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     102973021 (CDC42)    04933 AGE-RAGE signaling pathway in diabetic complications     102973021 (CDC42)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptg04131]     102973021 (CDC42)    03036 Chromosome and associated proteins [BR:ptg03036]     102973021 (CDC42)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptg04147]     102973021 (CDC42)    04031 GTP-binding proteins [BR:ptg04031]     102973021 (CDC42) Membrane trafficking [BR:ptg04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     102973021 (CDC42)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     102973021 (CDC42)   Macropinocytosis    Ras GTPases     102973021 (CDC42) Chromosome and associated proteins [BR:ptg03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     102973021 (CDC42) Exosome [BR:ptg04147]  Exosomal proteins   Exosomal proteins of microglial cells    102973021 (CDC42)   Exosomal proteins of breast milk    102973021 (CDC42) GTP-binding proteins [BR:ptg04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     102973021 (CDC42) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  102973021 NCBI-ProteinID:  XP_007083779 UniProt:  A0A8C9K4M2 LinkDB All DBs Position Un AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP EPKKTRRCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagacaattaagtgtgttgttgtgggcgatggtgccgttggtaaaacctgtctcctg atatcctacacaacaaataaatttccatcggagtatgtaccgactgtttttgacaactat gcagtcacagttatgattggtggagagccatatactcttggactttttgatactgcaggg caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc tgtttttcagtggtctctccatcctcatttgaaaatgtgaaggagaagtgggtgcctgag ataactcaccactgtccaaagactcctttcttgcttgttgggacccaaattgatctccga gatgacccctctacgattgagaaacttgccaagaacaaacagaagcctatcactccagag actgctgaaaagctggcccgtgacctgaaagcggtcaagtatgtggagtgttctgcactc acacagaaaggcctaaagaatgtatttgacgaagcgatattggctgccctggagcctcca gaaccgaagaagacccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system