Pelotomaculum thermopropionicum: PTH_0848 Help Entry PTH_0848          CDS       T00519                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pth  Pelotomaculum thermopropionicum Pathway pth00020   Citrate cycle (TCA cycle) pth00720   Other carbon fixation pathways pth01100   Metabolic pathways pth01110   Biosynthesis of secondary metabolites pth01120   Microbial metabolism in diverse environments pth01200   Carbon metabolism pth01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pth00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     PTH_0848   09102 Energy metabolism    00720 Other carbon fixation pathways     PTH_0848 Enzymes [BR:pth01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      PTH_0848 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_21 Fer4_10 Fer4_6 Fer4_7 Fer4_15 Fer4_16 Fer4_13 Fer4_9 Fer4_4 Fer4_17 LdpA_Fe-S-bd Fer4_22 Usp-48 Fer4_3 Motif Other DBs NCBI-ProteinID:  BAF59029 UniProt:  A5D3Y6 LinkDB All DBs Position complement(856472..856705) Genome browser AA seq 77 aa AA seqDB search MAAMAETVSSSTKKKAIVINKNWCKGCGICASLCSRVLAMDSTGKAVAVNPYLCTGCRVC ESHCPDFAISIGVEGIE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggcggcaatggctgagacagtatcttcttcaactaaaaagaaagcaatagttattaat aaaaactggtgcaaggggtgcggaatatgcgcatccctgtgctccagggtgctggctatg gacagcacgggcaaggcggtagccgtcaatccatacctttgcaccggctgccgcgtgtgc gaaagccactgtccggattttgccatttcgataggagtggaaggcattgaatga

DBGET integrated database retrieval system