Pelotomaculum thermopropionicum: PTH_1740 Help Entry PTH_1740          CDS       T00519                                  Symbol AcpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pth  Pelotomaculum thermopropionicum Pathway pth01100   Metabolic pathways pth01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pth00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PTH_1740 (AcpP)    00074 Mycolic acid biosynthesis     PTH_1740 (AcpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PTH_1740 (AcpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  BAF59921 UniProt:  A5D1H8 LinkDB All DBs Position complement(1824750..1824911) Genome browser AA seq 53 aa AA seqDB search MESSFVDDLGADSLDIVELVMALEEEFDLEIPDEDAEKIRTVGEAVKYIQDHQ NT seq 162 nt NT seq  +upstreamnt  +downstreamnt atggagtcatcatttgtagacgacctgggggcagactctttggatattgtggagcttgta atggccctggaagaggagtttgacctggaaatccccgatgaagatgcggagaaaattcgc acggtaggcgaagccgtgaagtatattcaggatcatcaatag

DBGET integrated database retrieval system