Providencia stuartii 2017-45-35: OI982_21860 Help Entry OI982_21860       CDS       T09168                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ptha  Providencia stuartii 2017-45-35 Brite KEGG Orthology (KO) [BR:ptha00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ptha03032]     OI982_21860    03036 Chromosome and associated proteins [BR:ptha03036]     OI982_21860    03400 DNA repair and recombination proteins [BR:ptha03400]     OI982_21860 DNA replication proteins [BR:ptha03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     OI982_21860 Chromosome and associated proteins [BR:ptha03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     OI982_21860 DNA repair and recombination proteins [BR:ptha03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       OI982_21860 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  WIJ76367 LinkDB All DBs Position p2017-45-35:80848..81120 Genome browser AA seq 90 aa AA seqDB search MNKSELIMKVAEDADISKAKAEAAVNALINSVTEELKAGGTVALTGFGTFHVKERAARTG RNPQTGENIQIAAANIPGFKAGKGLKDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaagtgaactgattatgaaagtggccgaagacgctgacattagcaaagcaaag gccgaagctgcggtaaatgcgctgatcaactcagtgacagaggagcttaaagcgggtggg acagtagcgctcactgggtttggtactttccacgttaaggaacgcgcagcgcgaaccggg cggaatccccagactggagagaacatccagatcgcggcggccaacattcctgggttcaaa gctggtaaggggttgaaagactccgtgaactag

DBGET integrated database retrieval system