Pseudodesulfovibrio thermohalotolerans: LF599_02845 Help Entry LF599_02845       CDS       T09613                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pthe  Pseudodesulfovibrio thermohalotolerans Pathway pthe00020   Citrate cycle (TCA cycle) pthe00720   Other carbon fixation pathways pthe01100   Metabolic pathways pthe01110   Biosynthesis of secondary metabolites pthe01120   Microbial metabolism in diverse environments pthe01200   Carbon metabolism pthe01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:pthe00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     LF599_02845   09102 Energy metabolism    00720 Other carbon fixation pathways     LF599_02845 Enzymes [BR:pthe01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      LF599_02845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_9 Fer4_10 Fer4_6 Fer4_17 Fer4_16 Fer4_4 Fer4_8 Fer4_20 Fer4_13 Fer4_15 Fer4_3 Fer4_18 Motif Other DBs NCBI-ProteinID:  WFS63116 LinkDB All DBs Position 615535..615747 Genome browser AA seq 70 aa AA seqDB search MSEKRHVIDARRCKACGLCVDNCPKDVLALGSTINAQGYNYVYQKNPDKCVLCDICGIVC PDVAIGVVVE NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagtgagaagcgtcatgtcattgatgcccgccgctgcaaggcctgcgggctctgcgtg gacaattgccccaaagatgtcctggccctcgggtccacgatcaacgcccagggatacaac tacgtgtatcagaagaaccccgacaagtgcgttctctgcgatatctgcggcattgtgtgc cctgacgttgccatcggcgtcgtcgttgaatag

DBGET integrated database retrieval system