Pseudodesulfovibrio thermohalotolerans: LF599_06720 Help Entry LF599_06720       CDS       T09613                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pthe  Pseudodesulfovibrio thermohalotolerans Pathway pthe01100   Metabolic pathways pthe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pthe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LF599_06720    00074 Mycolic acid biosynthesis     LF599_06720   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LF599_06720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  WFS63848 LinkDB All DBs Position 1439213..1439470 Genome browser AA seq 85 aa AA seqDB search MTDEEITARIDDLLAEEFELDPVAMKPEAQFKDDLDLDSLDAVDMVVVLEQAFHFKIKKD EAFQSIRTLGDLHAFVLEKKKFMTD NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgactgacgaggaaatcacagcacgtattgacgacctgctcgccgaggaattcgaactt gaccctgttgccatgaaaccagaggctcagttcaaggacgacctggacctggacagtctg gatgccgtcgatatggttgtggtcttggaacaggcgtttcatttcaaaattaaaaaggac gaggcgttccaatccatcagaactctaggcgacctgcatgcctttgttctggaaaagaaa aaatttatgaccgattaa

DBGET integrated database retrieval system