Paenibacillus thiaminolyticus: NDS46_27655 Help Entry NDS46_27655       CDS       T08812                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism pthi  Paenibacillus thiaminolyticus Pathway pthi00190   Oxidative phosphorylation pthi01100   Metabolic pathways Module pthi_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:pthi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     NDS46_27655 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:pthi00194]     NDS46_27655 (atpE) Photosynthesis proteins [BR:pthi00194]  Photosystem and electron transport system   F-type ATPase [OT]    NDS46_27655 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  WCF07991 LinkDB All DBs Position complement(6093952..6094164) Genome browser AA seq 70 aa AA seqDB search MEMLAAAIAVGLGALGAGLGNGMIVSRTVESIARQPEARNMLQTTMFIGVGIVEVIPLAA TVIAFLAMFS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggagatgttagcagcagcaattgcagtaggtttgggcgcattgggcgcaggtcttggt aacggtatgatcgtaagccgtacggtggagtcgattgcccgccaaccggaagcccgcaac atgttgcaaacgaccatgtttatcggtgtcggtatcgtcgaggttattccgctcgcagct acagttatcgcattcctggcaatgttctcttaa

DBGET integrated database retrieval system