KEGG   Pseudomonas thivervalensis: CE140_15530
Entry
CE140_15530       CDS       T11089                                 
Name
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
pthv  Pseudomonas thivervalensis
Brite
KEGG Orthology (KO) [BR:pthv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pthv03016]
    CE140_15530
Enzymes [BR:pthv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     CE140_15530
Transfer RNA biogenesis [BR:pthv03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    CE140_15530
 Prokaryotic type
    CE140_15530
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2 PUA_3
Other DBs
NCBI-ProteinID: AXA55719
UniProt: A0A176NPG3
LinkDB
Position
complement(3539701..3540618)
AA seq 305 aa
MAQVKRIRRNVSGIILLDKPLGFTSNAALQKVRWLLNAEKAGHTGSLDPLATGVLPLCFG
EATKFSQYLLDSDKGYETLAQLGKTTTTADAEGEVLLERPVTVGQADVEAVLPKFRGQIS
QIPPMYSALKRDGQPLYKLARAGEVVEREPRSVTIARLELLAFDGNTARLAVDCSKGTYI
RTLVEDIGEQLGCGAYVAELRRTQAGPFTLAQTVTLEELEAVHAEGGNEAVDRFLMPSDS
GLLDWPLLQFSEHSAFYWLNGQPVRAPDAPKFGMVRVQDHNGRFIGIGEVSEDGRIAPRR
LIRSE
NT seq 918 nt   +upstreamnt  +downstreamnt
gtggctcaggtcaaacgtatccgtcgtaatgtcagcggtatcatcctgctcgacaagccg
ctggggttcacgtccaacgcggcgttgcagaaggttcgctggctgctcaatgccgagaag
gccgggcacaccggtagcctcgatccgctggccaccggcgtgctgccgctgtgctttggc
gaggcgaccaagttctcccagtatctgctcgattccgacaagggttatgaaaccctggcg
caactgggcaagaccaccaccacggcggatgccgaaggtgaggttttgctggagcgtccg
gtgaccgttggtcaggcggatgtcgaagcggtgttgccgaaatttcgtgggcaaatcagc
cagataccgccgatgtactccgctttgaagcgcgatgggcagccgttgtataaactggcc
cgtgcaggcgaagtagtggagcgtgaaccgcgttctgttactattgcgcgcttggaattg
ctggcctttgacggtaatactgcgcggcttgccgtggattgcagcaaaggcacctatatc
cgcaccttggtggaggatattggtgagcagctcggctgtggcgcgtacgtggcagaattg
cgacggacccaggccgggcctttcaccttggcccagacggtcacgctggaagagctggaa
gcggtgcatgccgaaggcggcaacgaagcggtcgaccgtttcctgatgccatcggacagc
ggcttgcttgactggccactgctgcagttctccgaacacagcgcgttctactggctcaat
ggccagccagtacgtgccccggatgcgccgaagttcggcatggtccgggtgcaggatcac
aacggtcgcttcatcggtatcggtgaagtgagcgaagacgggcgcattgcgccgcgtcga
ctgattcggtcggaatga

DBGET integrated database retrieval system