Phaeodactylum tricornutum: PHATRDRAFT_10821 Help Entry PHATRDRAFT_10821  CDS       T01075                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism pti  Phaeodactylum tricornutum Pathway pti03020   RNA polymerase pti03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:pti00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     PHATRDRAFT_10821   09124 Replication and repair    03420 Nucleotide excision repair     PHATRDRAFT_10821  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:pti03021]     PHATRDRAFT_10821    03400 DNA repair and recombination proteins [BR:pti03400]     PHATRDRAFT_10821 Transcription machinery [BR:pti03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      PHATRDRAFT_10821   RNA polymerase III system    RNA polymerase III      PHATRDRAFT_10821   RNA polymerase I system    RNA polymerase I      PHATRDRAFT_10821 DNA repair and recombination proteins [BR:pti03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       PHATRDRAFT_10821 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 CpXC Motif Other DBs NCBI-GeneID:  7197863 NCBI-ProteinID:  XP_002178509 JGI:  10821 UniProt:  B7FTZ0 LinkDB All DBs Position 4:complement(<437297..>437676) Genome browser AA seq 73 aa AA seqDB search MIIPVRCFTCGKVIGNKWETYLSLLQADYSEGDALDELGLKRYCCRRMLLTHVDLIEKLL NYNTESSDVAVEG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcatacctgtacgatgctttacttgcggtaaagtgatcggaaacaaatgggagact tatctgagtctgttgcaggccgattattcagaaggcgatgctttggacgagctgggtttg aaacgatactgctgccgacgaatgctgttgacacacgttgatcttatcgaaaaattgcta aactacaatacagaaagctcggacgttgcggtcgaaggatga

DBGET integrated database retrieval system