Phaeodactylum tricornutum: PHATRDRAFT_16008 Help Entry PHATRDRAFT_16008  CDS       T01075                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism pti  Phaeodactylum tricornutum Pathway pti04517   IgSF CAM signaling pti04814   Motor proteins Brite KEGG Orthology (KO) [BR:pti00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     PHATRDRAFT_16008  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     PHATRDRAFT_16008  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pti03037]     PHATRDRAFT_16008    04812 Cytoskeleton proteins [BR:pti04812]     PHATRDRAFT_16008 Cilium and associated proteins [BR:pti03037]  Motile cilia and associated proteins   Dynein arm    PHATRDRAFT_16008 Cytoskeleton proteins [BR:pti04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      PHATRDRAFT_16008 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Cytidylate_kin Motif Other DBs NCBI-GeneID:  7195714 NCBI-ProteinID:  XP_002184123 JGI:  16008 UniProt:  B7GAR7 LinkDB All DBs Position 22:<389812..>390244 Genome browser AA seq 90 aa AA seqDB search MSEQRKAVIKNADMDEKMQQDAVDIASKALSEYNIEKDVAAYIKKEFDRKYNPTWHVIVG RNFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcgaacaacgaaaagcagtcatcaaaaatgctgacatggacgaaaagatgcaacaa gacgctgtagacatcgcttcgaaagcactatcggaatacaacattgaaaaggatgtcgcc gcttacattaaaaaggaattcgatcgaaagtacaatccgacatggcatgtaatcgtggga cgaaatttcggtagctatgtaacgcacgagacaaaacatttcatatacttttatctcggg caagttgccattctattgttcaagagtggatga

DBGET integrated database retrieval system