Phaeodactylum tricornutum: PHATRDRAFT_17885 Help Entry PHATRDRAFT_17885  CDS       T01075                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism pti  Phaeodactylum tricornutum Pathway pti03060   Protein export pti04141   Protein processing in endoplasmic reticulum pti04145   Phagosome Brite KEGG Orthology (KO) [BR:pti00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     PHATRDRAFT_17885    04141 Protein processing in endoplasmic reticulum     PHATRDRAFT_17885  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     PHATRDRAFT_17885  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pti04131]     PHATRDRAFT_17885   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pti02044]     PHATRDRAFT_17885 Membrane trafficking [BR:pti04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     PHATRDRAFT_17885 Secretion system [BR:pti02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    PHATRDRAFT_17885 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SecE Motif Other DBs NCBI-GeneID:  7196768 NCBI-ProteinID:  XP_002177474 JGI:  17885 UniProt:  B7FQV9 LinkDB All DBs Position 1:complement(2228231..2228483) Genome browser AA seq 73 aa AA seqDB search MSESKEGFKEVLIEPLQQFAKDSMHLVKKCTKPDRKEFTAIARATGVGFLIMGFIGFFVK LIHIPINNILVGN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgtcggaaagtaaagaaggtttcaaagaagttctgatcgaacctctccaacagttcgcg aaagactcgatgcacctcgtcaagaaatgcaccaagcccgaccgcaaagagttcaccgcc attgccagagcaaccggtgttggctttcttatcatggggtttatcggattctttgtgaag ctgattcacattccgatcaacaatattttggtcggaaactaa

DBGET integrated database retrieval system