Phaeodactylum tricornutum: PHATRDRAFT_52200 Help Entry PHATRDRAFT_52200  CDS       T01075                                  Name (RefSeq) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism pti  Phaeodactylum tricornutum Pathway pti03060   Protein export Brite KEGG Orthology (KO) [BR:pti00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     PHATRDRAFT_52200  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pti02044]     PHATRDRAFT_52200 Secretion system [BR:pti02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    PHATRDRAFT_52200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E YtxH Motif Other DBs NCBI-GeneID:  7202312 NCBI-ProteinID:  XP_002181489 JGI:  52200 UniProt:  B7G3S9 LinkDB All DBs Position 13:137208..137426 Genome browser AA seq 73 aa AA seqDB search MGLFGLGVPELAVIAIAAAFLLGPQKLAELGKDAGKIAGELKEVPAEFQKGLQEGETKAK SLKDEISVKEDEE NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgggtttgttcggacttggtgtcccggaacttgctgtgatagctatcgcggctgccttt ttgcttggacctcagaagttggcagaacttggaaaggatgctggaaagattgccggggaa ctcaaagaggtgcccgcggaatttcaaaaaggcctacaggaaggtgaaacgaaagcaaaa agcctaaaagacgaaatttctgtgaaggaagacgaagag

DBGET integrated database retrieval system