Pseudomonas tructae: EXN22_03105 Help Entry EXN22_03105       CDS       T07857                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptk  Pseudomonas tructae Pathway ptk01100   Metabolic pathways ptk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     EXN22_03105    00074 Mycolic acid biosynthesis     EXN22_03105   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     EXN22_03105 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QBF24725 UniProt:  A0A411MD12 LinkDB All DBs Position complement(666936..667208) Genome browser AA seq 90 aa AA seqDB search MSDPQNTLNHDIKLLIIDALGLEDISAQDIGDEQSLFGEGLGLDSVDALELGLAIQKKYG IKIDADAKDTRNHFTSVASLAAFVTAKQAA NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgagcgatccacagaacacccttaaccacgacatcaaactgttgatcatcgacgccctg ggccttgaagacatcagcgcccaggacatcggcgacgagcagagcctgttcggcgagggc ctgggcctggattcggtagacgccctcgagctcggcctggcgattcagaaaaagtacggc atcaagatcgatgccgacgccaaggacacccgtaaccatttcaccagcgtggccagcctt gcggctttcgtcaccgccaaacaggcagcctga

DBGET integrated database retrieval system