Paramecium tetraurelia: GSPATT00015444001 Help Entry GSPATT00015444001 CDS       T01055                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism ptm  Paramecium tetraurelia Pathway ptm03020   RNA polymerase ptm03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ptm00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     GSPATT00015444001   09124 Replication and repair    03420 Nucleotide excision repair     GSPATT00015444001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ptm03021]     GSPATT00015444001    03400 DNA repair and recombination proteins [BR:ptm03400]     GSPATT00015444001 Transcription machinery [BR:ptm03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      GSPATT00015444001   RNA polymerase III system    RNA polymerase III      GSPATT00015444001   RNA polymerase I system    RNA polymerase I      GSPATT00015444001 DNA repair and recombination proteins [BR:ptm03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       GSPATT00015444001 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Motif Other DBs NCBI-GeneID:  5033749 NCBI-ProteinID:  XP_001447964 Genoscope:  GSPATT00015444001 UniProt:  A0DC00 LinkDB All DBs Position undetermined AA seq 68 aa AA seqDB search MIIPIRCFTCGKVVGHLWSDYVQLLQDGVTTGESLDRLGLERYCCRRMILTHVDLIDKLL NYNIYKTL NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgattattcctatcagatgctttacttgtgggaaggtagtgggtcatttatggagtgat tatgtgcaattactctaagatggtgtgacaactggagaatccttagatagattgggtttg gagagatattgttgcagaagaatgatattaacacatgtagatttgatagacaaattgcta aactataatatttacaaaacactgtga

DBGET integrated database retrieval system