Paramecium tetraurelia: GSPATT00027151001 Help Entry GSPATT00027151001 CDS       T01055                                  Name (RefSeq) hypothetical protein   KO K03094   S-phase kinase-associated protein 1 Organism ptm  Paramecium tetraurelia Pathway ptm03083   Polycomb repressive complex ptm04120   Ubiquitin mediated proteolysis ptm04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ptm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     GSPATT00027151001    04120 Ubiquitin mediated proteolysis     GSPATT00027151001   09126 Chromosome    03083 Polycomb repressive complex     GSPATT00027151001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptm04131]     GSPATT00027151001    04121 Ubiquitin system [BR:ptm04121]     GSPATT00027151001    03036 Chromosome and associated proteins [BR:ptm03036]     GSPATT00027151001 Membrane trafficking [BR:ptm04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     GSPATT00027151001 Ubiquitin system [BR:ptm04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      GSPATT00027151001    Cul7 complex      GSPATT00027151001 Chromosome and associated proteins [BR:ptm03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      GSPATT00027151001   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      GSPATT00027151001 SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  5047983 NCBI-ProteinID:  XP_001462198 Genoscope:  GSPATT00027151001 UniProt:  A0EHN4 LinkDB All DBs Position undetermined AA seq 106 aa AA seqDB search MQFISQDGRTFKIDDKALKHCTKVSNTNLEVVNLTGIKSNILRKVIQYCQIHQNDAYIPK ISRPLKSNLIFEVVDFQDAEFITQLDFEEIFQIIQAAEVLGIDRLS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgtaatttatttcttaagatgggcgaacttttaagattgacgataaagcactaaaacac tgtactaaggtcagtaacactaatttagaagttgttaacttaactggtatcaaaagtaac atcttgaggaaggtcatataatattgctagatacattaaaacgatgcatatatcccaaaa atatcaagacctttgaaatcaaatctgatatttgaggttgtggattttcaagatgctgaa tttattacataactagactttgaagaaatattttaaattattcaagcagcagaagttctt ggcatagaccgccttagttga

DBGET integrated database retrieval system