Pseudoalteromonas translucida KMM 520: PTRA_b0579 Help Entry PTRA_b0579        CDS       T04220                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptn  Pseudoalteromonas translucida KMM 520 Pathway ptn01100   Metabolic pathways ptn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PTRA_b0579 (acpP)    00074 Mycolic acid biosynthesis     PTRA_b0579 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PTRA_b0579 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding RST Motif Other DBs NCBI-ProteinID:  ALS35037 UniProt:  A0A0U2VBD7 LinkDB All DBs Position II:559318..559563 Genome browser AA seq 81 aa AA seqDB search MKTAAEIYDVLHGILENDFEIDPADINLEANLYQDLDLDSIDAVDLVVKLREITGKKIDP DAFKQVRTVQNVVSEIEKLVN NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaaaaccgctgctgaaatttatgatgtattacacggcattttagaaaacgattttgag atagacccagccgatataaacctagaggctaacttatatcaagaccttgatttagacagc attgacgctgttgacttggtagtaaaactaagagaaatcaccggtaaaaaaattgatcct gatgcatttaaacaagtacgtactgtgcaaaatgtagttagcgaaatagaaaaactcgtt aactaa

DBGET integrated database retrieval system