KEGG   Picrophilus torridus: PTO1279
Entry
PTO1279           CDS       T00177                                 

Name
(GenBank) dihydrodipicolinate synthase
  KO
K18127  2-dehydro-3-deoxy-D-gluconate aldolase [EC:4.1.2.51]
Organism
pto  Picrophilus torridus
Pathway
pto00030  Pentose phosphate pathway
pto00052  Galactose metabolism
pto01100  Metabolic pathways
pto01120  Microbial metabolism in diverse environments
pto01200  Carbon metabolism
Module
pto_M00309  Non-phosphorylative Entner-Doudoroff pathway, gluconate/galactonate => glycerate
Brite
KEGG Orthology (KO) [BR:pto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PTO1279
   00052 Galactose metabolism
    PTO1279
Enzymes [BR:pto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.51  2-dehydro-3-deoxy-D-gluconate aldolase
     PTO1279
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AAT43864
UniProt: Q6KZI8
Structure
LinkDB
Position
1285256..1286056
AA seq 266 aa
MITPLDAHGNIDYNATNILIKYLEGINVDYLFPMGSTGVFPYFTLKERKDFLKFVRENSK
KPIMAGVGSSSINEVNELMKFSMDIGIEAAVLMPPYYIKLNQEAIYHYYKEILSSNDMDL
LIYNIPQFTNKIDPETVKNLKSEFSSVKGVKDSSADIRGFMEMLSLSDDDFAVFQGQDDL
LFTSLELGASGGVCGTTNFSDGIVRLYHEYKNNREMALKIEKNDVIPLMKKLGKYQFPNA
YYEYFYKKNNINGGYRPPMYRVGIEI
NT seq 801 nt   +upstreamnt  +downstreamnt
atgataacgcctcttgatgcccatggaaatatagattacaatgcaacaaacattcttata
aaatacctggagggcataaacgttgattatctttttccaatgggctccacaggagtcttt
ccatattttacattaaaggaaagaaaggattttttgaagtttgtaagggagaattcaaaa
aaacccataatggcaggcgttggctcttcttcaataaatgaggttaatgagctaatgaaa
ttctccatggatataggcatagaggctgccgttttaatgccgccatattatattaagcta
aaccaggaggcaatataccattactataaagagatactgtcatcaaacgatatggacctt
ttaatatataatataccgcagtttacaaataaaatcgatccagaaactgttaagaaccta
aaatcggagttttcatctgtaaaaggcgtaaaggacagctctgctgatataagaggcttc
atggagatgctatcattatcagatgatgattttgcagttttccagggccaggacgatcta
ctttttacatctcttgagctgggtgcttcaggaggggtctgcggaaccacaaatttcagt
gatggtatagtaaggctttaccatgagtataaaaacaatagggaaatggcacttaaaata
gaaaaaaatgatgtaataccattaatgaaaaagcttggaaaataccagtttccaaatgca
tactatgagtacttctacaaaaagaataatataaatggtggatacaggcctccaatgtac
agggtaggcattgaaatataa

DBGET integrated database retrieval system