Planktomarina temperata: RCA23_c00970 Help Entry RCA23_c00970      CDS       T03229                                  Symbol atpE Name (GenBank) ATP synthase subunit c   KO K02110   F-type H+-transporting ATPase subunit c Organism ptp  Planktomarina temperata Pathway ptp00190   Oxidative phosphorylation ptp01100   Metabolic pathways Module ptp_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ptp00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     RCA23_c00970 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ptp00194]     RCA23_c00970 (atpE) Photosynthesis proteins [BR:ptp00194]  Photosystem and electron transport system   F-type ATPase [OT]    RCA23_c00970 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AII85666 UniProt:  A0AAN0RGD3 LinkDB All DBs Position 100189..100425 Genome browser AA seq 78 aa AA seqDB search MTGDIVQMGAYIGAGLACIGMGGAALGVGNVVGNFLSGALRNPSAAGGQTATMFIGIAFA EALGIFSFLVALLLMFAV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgactggcgatatcgtacaaatgggtgcttacatcggtgctggcttggcttgtattggc atgggcggcgcggctcttggtgtgggcaatgttgtgggcaacttcctgtccggcgctttg cgcaatccttccgctgctggcggtcaaactgcaacgatgttcattggtattgcgttcgca gaagctttggggatcttctcattcctcgtcgctctgctgctgatgttcgcagtataa

DBGET integrated database retrieval system