Planktomarina temperata: RCA23_c04550 Help Entry RCA23_c04550      CDS       T03229                                  Symbol hup Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism ptp  Planktomarina temperata Brite KEGG Orthology (KO) [BR:ptp00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ptp03032]     RCA23_c04550 (hup)    03036 Chromosome and associated proteins [BR:ptp03036]     RCA23_c04550 (hup)    03400 DNA repair and recombination proteins [BR:ptp03400]     RCA23_c04550 (hup) DNA replication proteins [BR:ptp03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RCA23_c04550 (hup) Chromosome and associated proteins [BR:ptp03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RCA23_c04550 (hup) DNA repair and recombination proteins [BR:ptp03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RCA23_c04550 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AII86015 UniProt:  A0AAN0RH48 LinkDB All DBs Position 488882..489214 Genome browser AA seq 110 aa AA seqDB search MEIGAQGVGLVRRKYMSKPMTKTQLVAALAEKMGTDKKSAAASLDAICELITSEVSGGGA VTLPGVGKIYCRERPERMVRNPATGESFKKDADKVVKMTIAKALKDSVNG NT seq 333 nt NT seq  +upstreamnt  +downstreamnt ttggagattggtgcccaaggtgttgggcttgttaggagaaaatatatgtcgaaacctatg acgaaaacacaattggttgccgcattggcagagaaaatgggcacggataaaaaatccgca gcggcctcgttggatgcgatctgtgagttgatcaccagcgaagtttccggcggcggcgct gtgactttgccaggtgttggcaaaatctattgccgtgagcgtccagagcggatggtgcgc aaccccgccactggtgaaagcttcaaaaaagatgcggataaagttgtcaaaatgaccatt gcgaaagcgctcaaagacagcgtaaacggttaa

DBGET integrated database retrieval system