Planktomarina temperata: RCA23_c15020 Help Entry RCA23_c15020      CDS       T03229                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptp  Planktomarina temperata Pathway ptp01100   Metabolic pathways ptp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RCA23_c15020    00074 Mycolic acid biosynthesis     RCA23_c15020   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RCA23_c15020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AII87040 UniProt:  A0AAN0VIC6 LinkDB All DBs Position 1616840..1617097 Genome browser AA seq 85 aa AA seqDB search MSVKDKVIQIIAEQGLLDVADVSLTATLEELGIDSLGVVESIFAIEEEFDIEVPFNANAP QESEFDISSVATIISAVETLVAEQT NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagtgtaaaagacaaggtcattcaaatcattgctgagcaaggtctgctggatgtggct gatgtgagcctaacggccacgctagaggagctgggcattgacagccttggcgtggtggaa agtattttcgcgatcgaagaagaattcgacatcgaagtgccgtttaatgccaatgccccg caggaaagtgaatttgatatatcctctgtggcgaccattatttctgcggttgaaaccctt gttgcggagcagacctag

DBGET integrated database retrieval system