Planktomarina temperata: RCA23_c15800 Help Entry RCA23_c15800      CDS       T03229                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism ptp  Planktomarina temperata Pathway ptp02024   Quorum sensing ptp03018   RNA degradation Brite KEGG Orthology (KO) [BR:ptp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     RCA23_c15800 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     RCA23_c15800 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ptp03019]     RCA23_c15800 (hfq)    03036 Chromosome and associated proteins [BR:ptp03036]     RCA23_c15800 (hfq) Messenger RNA biogenesis [BR:ptp03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      RCA23_c15800 (hfq) Chromosome and associated proteins [BR:ptp03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     RCA23_c15800 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AII87117 UniProt:  A0AAN0VIL7 LinkDB All DBs Position 1701080..1701313 Genome browser AA seq 77 aa AA seqDB search MASDKQNLQDAFLNQVRKTKVPVTIFLINGVKLQGVVTWFDNFCVLLRRDGASQLVYKHA ISTIMPAQPISLYDGEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcttccgataaacaaaacttacaagacgcatttctcaatcaagtgcgcaaaaccaag gttcctgtcaccatctttttgatcaatggcgtgaagctgcaaggcgttgtcacatggttt gacaatttctgcgtgctcttgcgccgcgatggggcatcgcaattggtttataaacatgcg atttcaaccattatgccagcgcagccaatttctctttatgacggtgaagaatag

DBGET integrated database retrieval system