Planktomarina temperata: RCA23_c18080 Help Entry RCA23_c18080      CDS       T03229                                  Symbol acpP Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism ptp  Planktomarina temperata Pathway ptp01100   Metabolic pathways ptp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RCA23_c18080 (acpP)    00074 Mycolic acid biosynthesis     RCA23_c18080 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RCA23_c18080 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AII87340 UniProt:  A0AAN0VIM9 LinkDB All DBs Position complement(1938947..1939180) Genome browser AA seq 77 aa AA seqDB search MSDVADRVKKIVVEHLGVEEDKVVENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKHISEAV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtagctgaccgcgttaagaaaattgttgtagagcacctgggtgtagaggaa gataaagttgtagagaatgcatctttcatcgatgaccttggcgcagatagcctggacaca gttgaactggttatggctttcgaagaagagttcggaattgaaattcctgacgatgcagct gaaacgattcaaaccttcggcgacgctgtaaagcatatctctgaagccgtttaa

DBGET integrated database retrieval system