KEGG   Puccinia triticina (wheat leaf rust): PtA15_9A607
Entry
PtA15_9A607       CDS       T09180                                 
Name
(RefSeq) uncharacterized protein
  KO
K03094  S-phase kinase-associated protein 1
Organism
ptrc  Puccinia triticina (wheat leaf rust)
Pathway
ptrc03083  Polycomb repressive complex
ptrc04111  Cell cycle - yeast
ptrc04120  Ubiquitin mediated proteolysis
ptrc04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ptrc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PtA15_9A607
   04120 Ubiquitin mediated proteolysis
    PtA15_9A607
  09126 Chromosome
   03083 Polycomb repressive complex
    PtA15_9A607
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    PtA15_9A607
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ptrc04131]
    PtA15_9A607
   04121 Ubiquitin system [BR:ptrc04121]
    PtA15_9A607
   03036 Chromosome and associated proteins [BR:ptrc03036]
    PtA15_9A607
Membrane trafficking [BR:ptrc04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    PtA15_9A607
Ubiquitin system [BR:ptrc04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     PtA15_9A607
   Cul7 complex
     PtA15_9A607
Chromosome and associated proteins [BR:ptrc03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     PtA15_9A607
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     PtA15_9A607
SSDB
Motif
Pfam: Skp1 Skp1_POZ BTB
Other DBs
NCBI-GeneID: 77813729
NCBI-ProteinID: XP_053024035
LinkDB
Position
9A:join(6163746..6163762,6163888..6163961,6164051..6164218,6164298..6164370,6164442..6164517,6164595..6164654,6164730..6164738)
AA seq 158 aa
MVVLVTSDGEQFTIDREVAIRSVLIKNMIEDVGESDNPIPLPNVSASVLKKVIEWCEHHK
KDPEPSTEDPDDARKRATEISDWDTKFINVDQEMLFEIILAANYLDIKPLLDVGCKSVAN
MIKGKQPDEIRKLFNITNDFTPEEEAQIKKENEWAEDR
NT seq 477 nt   +upstreamnt  +downstreamnt
atggttgtcttagtaacatctgatggcgagcagttcaccattgaccgggaagtcgcgatc
aggagtgttctgatcaagaacatgatcgaagatgttggagagtctgacaacccgatccca
ctgcccaacgtctcagccagtgtgctgaaaaaggtcattgaatggtgcgagcaccataag
aaggatcccgagccctccaccgaggatcccgacgacgctcggaaacgagctactgaaatc
agcgattgggatactaaatttatcaacgttgatcaggagatgcttttcgagatcatcttg
gctgcgaactacttggacatcaagcctttactggatgtcggctgcaagtcggtcgccaac
atgatcaaaggcaagcaacccgacgagatccggaagctcttcaacatcacaaacgatttc
acgcctgaagaagaggcacagatcaagaaggaaaacgaatgggcagaggaccgatga

DBGET integrated database retrieval system