Pseudomonas tremae: I9H09_16645 Help Entry I9H09_16645       CDS       T08237                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptre  Pseudomonas tremae Pathway ptre00998   Biosynthesis of various antibiotics ptre01100   Metabolic pathways ptre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptre00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I9H09_16645 (acpP)    00074 Mycolic acid biosynthesis     I9H09_16645 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I9H09_16645 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  UQB35192 LinkDB All DBs Position complement(3701310..3701546) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEDEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgttgccgagcaacttggcgtcaaagaa gacgaggttgtcaacactgcttctttcgttgaagacctgggcgctgactccctggacacc gtcgagctggtaatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcg gaaaagatcactaccgttcaagcagcaatcgattacgtcactagccatcaggcttaa

DBGET integrated database retrieval system