Pseudomonas tremae: I9H09_22055 Help Entry I9H09_22055       CDS       T08237                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptre  Pseudomonas tremae Pathway ptre00998   Biosynthesis of various antibiotics ptre01100   Metabolic pathways ptre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptre00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I9H09_22055    00074 Mycolic acid biosynthesis     I9H09_22055   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I9H09_22055 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UQB36172 LinkDB All DBs Position 4914426..4914689 Genome browser AA seq 87 aa AA seqDB search MSDLHQDIKLLIIDALGLEDITPEDIGNDMTLFGEGLGLDSVDALELGLAIQKRYGIRID ADAKDTRNHFASVDSLAAFVSANRPEN NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaccaggacattaaattgttgatcatcgatgccctgggcctcgaagac atcactccggaggatatcggcaacgatatgacgttgttcggcgaaggacttggcctggat tcggtcgatgcactggaattgggtctagccatccagaagcgctacggcatcaggatcgac gccgatgcaaaagacacacgtaaccattttgccagcgtcgacagcctagcggccttcgtc agcgccaaccggcctgagaattga

DBGET integrated database retrieval system