Pseudomonas tremae: I9H09_22060 Help Entry I9H09_22060       CDS       T08237                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptre  Pseudomonas tremae Pathway ptre00998   Biosynthesis of various antibiotics ptre01100   Metabolic pathways ptre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptre00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     I9H09_22060    00074 Mycolic acid biosynthesis     I9H09_22060   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     I9H09_22060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 DUF7080 DUF4956 Motif Other DBs NCBI-ProteinID:  UQB36173 LinkDB All DBs Position 4914692..4914946 Genome browser AA seq 84 aa AA seqDB search MQTREDIFEILRTAMVELFELEAERVTLDANLYQDLEIDSIDAVDLIDHIKRKTGKKIAA EEFKSVKTVNDVVEAVYRLVNATE NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaacccgtgaagacatcttcgaaatcctgcgcaccgcaatggtggaactgttcgaa ctggaggccgagagggtcacgcttgacgctaacctctatcaggacctggaaatcgacagc attgacgccgtggacttgatcgaccacatcaaacgcaagacagggaagaagatcgccgct gaagagttcaagtcggtcaagaccgtgaacgacgtggtcgaggctgtttaccgactggtc aacgcgaccgaatga

DBGET integrated database retrieval system