Pseudomonas tremae: I9H09_26325 Help Entry I9H09_26325       CDS       T08237                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ptre  Pseudomonas tremae Brite KEGG Orthology (KO) [BR:ptre00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ptre03032]     I9H09_26325    03036 Chromosome and associated proteins [BR:ptre03036]     I9H09_26325    03400 DNA repair and recombination proteins [BR:ptre03400]     I9H09_26325 DNA replication proteins [BR:ptre03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     I9H09_26325 Chromosome and associated proteins [BR:ptre03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     I9H09_26325 DNA repair and recombination proteins [BR:ptre03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       I9H09_26325 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 HU-HIG HU-CCDC81_euk_2 SSPI Motif Other DBs NCBI-ProteinID:  UQB39588 LinkDB All DBs Position p2:1498..1812 Genome browser AA seq 104 aa AA seqDB search MALTKDQLVAGIAEAIDAPKTTARKTLEQLGQIVAEQLESGAEITLPGIGKLKVAERPAR TGRNPSTGAAIEIAAKKAIKFVPAKVLNDAINHGASQKTENKTR NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggctctgacgaaagaccaattggttgccggtattgcagaagctatcgatgcgccaaaa accaccgcgcgcaagactcttgagcaattgggacagatcgttgccgaacaactggaaagc ggtgcagaaatcactctaccgggcatcggcaaactgaaagttgcagagcgtccagcacgt actggccgcaacccttcgactggtgccgctatcgaaattgctgccaagaaagctatcaag ttcgtccctgccaaggtgctgaacgacgcgatcaaccacggtgcgtctcagaaaacggaa aataaaacacgttaa

DBGET integrated database retrieval system