Paenibacillus tritici: KDC22_10765 Help Entry KDC22_10765       CDS       T07560                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptri  Paenibacillus tritici Pathway ptri00998   Biosynthesis of various antibiotics ptri01100   Metabolic pathways ptri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptri00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KDC22_10765    00074 Mycolic acid biosynthesis     KDC22_10765   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KDC22_10765 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  QUL56907 LinkDB All DBs Position 2578706..2578957 Genome browser AA seq 83 aa AA seqDB search MDDREQELRKLLAQLPGGPSRMKDAGMDVDLRSYGMDSLLFIHFAVVLEEHFSIEVSPEF LDIDKLYSLQKWREYIDSQDLVC NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggatgacagagaacaggagctgcgtaagctgctcgctcaattgcccggcggtccttcc cggatgaaggatgcaggtatggacgtggatttgcgaagctatggcatggattctttgttg tttattcattttgcagtggtcctggaagagcatttctccatagaggtaagcccggaattt ctcgatatagataaactgtacagtcttcagaagtggagagaatatattgattcacaggat cttgtatgctag

DBGET integrated database retrieval system