Paenibacillus tritici: KDC22_17435 Help Entry KDC22_17435       CDS       T07560                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism ptri  Paenibacillus tritici Pathway ptri00998   Biosynthesis of various antibiotics ptri01100   Metabolic pathways ptri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptri00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KDC22_17435    00074 Mycolic acid biosynthesis     KDC22_17435   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KDC22_17435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ig_mannosidase WCOB Motif Other DBs NCBI-ProteinID:  QUL52253 LinkDB All DBs Position 4082172..4082447 Genome browser AA seq 91 aa AA seqDB search MIKQGVTQQIIQIIEQKISSSSGSSFTDVTITADTLLRDVWLRLESIQVVEFVVELETSY EIALPDELLGQIDRSSMKVSDLAAIIEGEEG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgattaaacaaggtgtaacccagcagattattcaaatcatcgagcaaaaaatatcgtct tcctctggatcttcctttacggatgttaccattacggcagacacactgcttcgcgatgtg tggctcaggctggaatccattcaagtcgttgaatttgtcgtggagctggagacttcctac gagattgcgctgccggatgaactcctgggccagattgacagaagctcaatgaaagtatct gatctggccgccatcatcgaaggtgaagaggggtag

DBGET integrated database retrieval system