Paraburkholderia tropica: G5S35_09985 Help Entry G5S35_09985       CDS       T07044                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ptro  Paraburkholderia tropica Pathway ptro00998   Biosynthesis of various antibiotics ptro01100   Metabolic pathways ptro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ptro00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G5S35_09985 (acpP)    00074 Mycolic acid biosynthesis     G5S35_09985 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G5S35_09985 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 DUF1896 DUF1493 Motif Other DBs NCBI-ProteinID:  QNB11870 LinkDB All DBs Position A:complement(2229442..2229681) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVAEAEIKNEASFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYARANVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgaacagcgcgtcaagaagatcgtcgccgagcaactgggcgtcgccgaa gctgaaatcaagaacgaagcttcgttcgtgaacgatctgggcgccgactcgctcgacacc gtcgagctcgtgatggccctcgaagacgaattcggcatggaaatcccggatgaggaagcc gagaagatcacgacggttcagcaagcgatcgactacgctcgcgcgaacgtcaaggcctaa

DBGET integrated database retrieval system