Paraburkholderia tropica: G5S35_16065 Help Entry G5S35_16065       CDS       T07044                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism ptro  Paraburkholderia tropica Brite KEGG Orthology (KO) [BR:ptro00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptro03036]     G5S35_16065    03400 DNA repair and recombination proteins [BR:ptro03400]     G5S35_16065 Chromosome and associated proteins [BR:ptro03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     G5S35_16065 DNA repair and recombination proteins [BR:ptro03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       G5S35_16065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RsiG Histone_HNS_N Motif Other DBs NCBI-ProteinID:  QNB13177 LinkDB All DBs Position B:308372..308632 Genome browser AA seq 86 aa AA seqDB search MATYLELLAEKRALDARIDALRAEAADEALAAARAAIAEFGFTPDDLFGKPRAKREKKGA ARSRKNASAQDADHGNLDLFGGSGAN NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggcaacttacctcgaattgctcgccgaaaagcgtgcgctcgacgcgcgtatcgatgcg ttgcgcgccgaggcggccgacgaagcactcgcggccgcccgcgccgccatcgccgaattc ggtttcacgccggacgacctgttcggcaaaccgcgcgcgaaacgcgagaaaaaaggcgcg gcccgttcgcgcaagaatgcgtccgcgcaagatgccgaccacggcaatctcgatcttttc ggcggctccggcgcaaattga

DBGET integrated database retrieval system