KEGG   Paraburkholderia tropica: G5S35_20030
Entry
G5S35_20030       CDS       T07044                                 
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
ptro  Paraburkholderia tropica
Pathway
ptro02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ptro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    G5S35_20030 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ptro02000]
    G5S35_20030 (phnC)
Enzymes [BR:ptro01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     G5S35_20030 (phnC)
Transporters [BR:ptro02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    G5S35_20030 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_16 SMC_N AAA_25 AAA_22 AAA_29 nSTAND1 RsgA_GTPase SbcC_Walker_B NACHT AAA_33 AAA_28 MMR_HSR1 FtsK_SpoIIIE nSTAND3 AAA_19 AAA_5 TsaE AAA_23 NB-ARC
Other DBs
NCBI-ProteinID: QNB13864
LinkDB
Position
B:1182133..1183002
AA seq 289 aa
MDAIRIERLSKTFGPQRKALDEINLRVGTGEMVALIGASGSGKSTLLRHIAGFVAADAQP
SRIEILGRPIQQDGRIVREVRRIRRDVGFVFQQFNLVHRLTVETNVLIGALARLPLWRRL
TGRFPRSERELSIAALAEVGIADKAYERAANLSGGQQQRAALARALVQRARLILADEPIA
SLDPESSRRVMDMLRMLNRNHGLTVVVSLHQVDIAMQYCPRTVALRDGRVVYDGPSAALT
PELLQKLYGSAARELRDADGAHDQSLEQPLEQSLMQAHTQHFGAQPTAA
NT seq 870 nt   +upstreamnt  +downstreamnt
atggacgcaattcgaatcgaacgactgtcgaagacttttggaccgcagcgcaaggcgctc
gacgaaatcaacctgcgcgtgggcacgggagaaatggtcgcgctgatcggcgcgtcggga
tcgggcaaatcgactttgctgcgccatatcgcgggcttcgtcgccgccgatgcgcagcct
tcgcgcatcgagattctcggccgcccgatccagcaggacggacgcatcgtgcgcgaagtg
cgccgcattcgccgcgacgtcggcttcgtgtttcagcaattcaatctcgtgcatcgtttg
accgtcgagaccaacgtgctgatcggcgcgctcgcgcgcctgccgctgtggcggcgtctc
acgggccgctttccgcgcagcgaacgcgaactgtcgattgcggcgcttgcggaagtgggc
atcgccgataaagcgtacgagcgtgccgcgaatctctcgggcggccagcagcagcgcgcc
gcgctcgcgcgtgcgctggtgcagcgcgcgcgcctgattctcgccgacgagccgatcgcc
tcgctcgaccccgaatcgtcgcgccgcgtgatggacatgctgcgcatgctcaatcgcaat
cacgggcttacggtggtggtgtcgctgcatcaggtggatatcgccatgcagtattgcccg
cgcacggtcgcgctgcgcgacggccgcgtggtctacgacgggccgtccgccgcgctcacg
cccgagttgctgcaaaagctctatggcagcgccgcgcgcgaattgcgcgacgcggatggc
gcgcacgatcagtcgctggaacagccgctcgaacaatcactgatgcaagcgcacacgcag
catttcggcgcgcagccgacggcggcctag

DBGET integrated database retrieval system