Paraburkholderia tropica: G5S35_35095 Help Entry G5S35_35095       CDS       T07044                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism ptro  Paraburkholderia tropica Pathway ptro00362   Benzoate degradation ptro00621   Dioxin degradation ptro00622   Xylene degradation ptro01100   Metabolic pathways ptro01120   Microbial metabolism in diverse environments ptro01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:ptro00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     G5S35_35095    00622 Xylene degradation     G5S35_35095    00621 Dioxin degradation     G5S35_35095 Enzymes [BR:ptro01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      G5S35_35095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_3 Tautomerase_2 Motif Other DBs NCBI-ProteinID:  QNB16798 LinkDB All DBs Position D:1078526..1078711 Genome browser AA seq 61 aa AA seqDB search MPILRIEMHPGKTLEQKRELASGITRVFVETLACPPEVVEIVFNEIEKDAWAVGGKLKSD T NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgcctatccttcgaattgaaatgcatccgggcaagacgctcgaacaaaagcgcgaactc gcaagcggcattacgcgtgtgttcgtcgaaaccttggcgtgtccgcccgaggtcgtcgaa atcgtctttaacgaaatcgaaaaggacgcgtgggcggtcggcggaaaactgaaatccgat acgtga

DBGET integrated database retrieval system