Paraburkholderia tropica: G5S35_36965 Help Entry G5S35_36965       CDS       T07044                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism ptro  Paraburkholderia tropica Brite KEGG Orthology (KO) [BR:ptro00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ptro03036]     G5S35_36965    03400 DNA repair and recombination proteins [BR:ptro03400]     G5S35_36965 Chromosome and associated proteins [BR:ptro03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     G5S35_36965 DNA repair and recombination proteins [BR:ptro03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       G5S35_36965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YscO-like VanY NYD-SP28_assoc Motif Other DBs NCBI-ProteinID:  QNB17117 LinkDB All DBs Position D:complement(1559976..1560230) Genome browser AA seq 84 aa AA seqDB search MVAGKTNVVKRADALFEAPKADASTEKTMSSYRSLLAQRAELEAKIAAARDEEVAHALLK FFPIKDGMRAGSTNCFYASGCRLR NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atggtagccgggaagacgaatgtagtaaaacgggcagacgcgcttttcgaggcgcccaag gcagacgcgtcaactgaaaaaacgatgtctagctaccgctccttgctggcgcagcgtgca gaactcgaagcgaagatcgccgcagctcgggacgaggaagtagcgcacgctcttctgaaa ttttttccaattaaagacgggatgcgcgccggctcgaccaactgcttctacgcttcggga tgtcgactgcgataa

DBGET integrated database retrieval system