Pyrenophora tritici-repentis: 6343003 Help Entry 6343003           CDS       T10215                                  Symbol PtrM4_117140 Name (RefSeq) dynein light chain type 1   KO K10418   dynein light chain LC8-type Organism ptrr  Pyrenophora tritici-repentis Pathway ptrr04517   IgSF CAM signaling ptrr04814   Motor proteins Brite KEGG Orthology (KO) [BR:ptrr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     6343003 (PtrM4_117140)  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     6343003 (PtrM4_117140)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ptrr03037]     6343003 (PtrM4_117140)    04812 Cytoskeleton proteins [BR:ptrr04812]     6343003 (PtrM4_117140) Cilium and associated proteins [BR:ptrr03037]  Motile cilia and associated proteins   Dynein arm    6343003 (PtrM4_117140) Cytoskeleton proteins [BR:ptrr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      6343003 (PtrM4_117140) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light P2_N Motif Other DBs NCBI-GeneID:  6343003 NCBI-ProteinID:  XP_001935094 UniProt:  A0A2W1DF91 B2W561 LinkDB All DBs Position 6:complement(<1308756..>1309383) Genome browser AA seq 96 aa AA seqDB search MASEKSDAHKQEAQIKSADMSEEMQQEAIEVATMAMEQFTIEKDIAQYIKKEFDSRKGAT WHCIVGRNFGSFVTHETKHFIYFYLGHCAILLFKTQ NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcaagcgagaagtcagatgcccacaagcaggaagcccagatcaagtcggccgacatg agcgaagagatgcagcaagaggctattgaagtcgcaacaatggctatggagcagttcact attgagaaggacatcgcccagtacatcaagaaagagtttgacagccgaaagggcgccaca tggcactgcatcgtaggccgcaactttggaagcttcgtcactcatgagacgaaacacttc atctacttctacctcggtcactgcgctattctgttgttcaagactcagtaa

DBGET integrated database retrieval system