KEGG Orthology (KO) [BR:ptrr00001]
09120 Genetic Information Processing
09121 Transcription
03020 RNA polymerase
6345270 (PtrM4_043990)
09124 Replication and repair
03420 Nucleotide excision repair
6345270 (PtrM4_043990)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03021 Transcription machinery [BR:ptrr03021]
6345270 (PtrM4_043990)
03400 DNA repair and recombination proteins [BR:ptrr03400]
6345270 (PtrM4_043990)
Transcription machinery [BR:ptrr03021]
Eukaryotic type
RNA polymerase II system
RNA polymerase II
Pol I, II, III common subunits
6345270 (PtrM4_043990)
RNA polymerase III system
RNA polymerase III
6345270 (PtrM4_043990)
RNA polymerase I system
RNA polymerase I
6345270 (PtrM4_043990)
DNA repair and recombination proteins [BR:ptrr03400]
Eukaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
TCR (transcription coupled repair) factors
DNA-directed RNA polymerase II complex
6345270 (PtrM4_043990)
163 aa
MSDYGGDDYGGDAGDMGDDHAIDFDEEAEPDLMDDEDDQPGGGEDPDNADPNDDNVVVSG
DANAAAAAKEASKNTVTSEKDKRVPNEKRTTTPYMTKYEKARVLGTRALQISGNAPVLID
VEGMTDPLQIAAKELQEKKIPLVVRRYLPDGFYEDWTCEELLT
