Pyrenophora tritici-repentis: 6348231 Help Entry 6348231           CDS       T10215                                  Symbol PtrM4_084930 Name (RefSeq) Snf7 domain containing protein   KO K12191   charged multivesicular body protein 2A Organism ptrr  Pyrenophora tritici-repentis Pathway ptrr04144   Endocytosis Brite KEGG Orthology (KO) [BR:ptrr00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     6348231 (PtrM4_084930)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ptrr04131]     6348231 (PtrM4_084930)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ptrr04147]     6348231 (PtrM4_084930) Membrane trafficking [BR:ptrr04131]  Endosome - Lysosome transport   Endosomal sorting complexes required for transport (ESCRT)    ESCRT-III complex     6348231 (PtrM4_084930) Exosome [BR:ptrr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    6348231 (PtrM4_084930)   Exosomal proteins of other body fluids (saliva and urine)    6348231 (PtrM4_084930)   Exosomal proteins of colorectal cancer cells    6348231 (PtrM4_084930) SSDB OrthologParalogGFIT Motif Pfam:  Snf7 DUF6680 Motif Other DBs NCBI-GeneID:  6348231 NCBI-ProteinID:  XP_001940265 LinkDB All DBs Position 3:<2904732..>2905193 Genome browser AA seq 122 aa AA seqDB search MMQSMKGATTLLGSMNRQMNLPALQRIAMEFEKENDIMDQRQEMMDDAIDDATGMEDEEE SEDVVNQVLDEIGIDLGQALGETPSGLQKNAVPEARVAQAIGGGGADPDDDDLQARLDSL RR NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgatgcagtccatgaagggcgcaacaacactgcttggaagcatgaacaggcagatgaac ctccctgcgctacagcgcattgccatggagttcgagaaagaaaacgacatcatggaccag cgacaggagatgatggacgatgctattgacgacgccactggcatggaagacgaggaggag agcgaggatgttgtcaatcaagtcctggatgagataggcattgatcttggccaagctctg ggagaaaccccgagcggattacaaaagaacgcagtgccagaggccagggtcgcgcaggcc attgggggtggaggtgctgatcccgacgacgatgaccttcaggctcgattggacagcttg aggaggtga

DBGET integrated database retrieval system